(data stored in ACNUC30630 zone)

EMBL: CP002049.PE402

CP002049.PE402       Location/Qualifiers
FT   CDS             455573..456205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0407"
FT                   /product="beta-lactamase-like protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: dge:Dgeo_2261 beta-lactamase-like
FT                   protein; SPTR: Q1IW29 Beta-lactamase-like protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13545"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ5"
FT                   /protein_id="ADI13545.1"
FT                   /translation="MLSLSGFCVGPLQENTYLLADTETLEAVLVDPGDEAERLLAALAG
FT                   FKLTAIWLTHAHFDHVGALAAVHEAHPVPVYLHPADRPLLAQAAASAALFGLPLRQPEL
FT                   PTLPLAHAQQLQVGAYRARCLHTPGHAPGHVAFYLAEAGVLLAGDALFRGSIGRTDLPG
FT                   GDLETLLRSLRDEVLTLPDETRVLPGHGPETTVGSERRRNPFLQGLA"
     MLSLSGFCVG PLQENTYLLA DTETLEAVLV DPGDEAERLL AALAGFKLTA IWLTHAHFDH        60
     VGALAAVHEA HPVPVYLHPA DRPLLAQAAA SAALFGLPLR QPELPTLPLA HAQQLQVGAY       120
     RARCLHTPGH APGHVAFYLA EAGVLLAGDA LFRGSIGRTD LPGGDLETLL RSLRDEVLTL       180
     PDETRVLPGH GPETTVGSER RRNPFLQGLA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page