(data stored in ACNUC30630 zone)

EMBL: CP002049.PE403

CP002049.PE403       Location/Qualifiers
FT   CDS             456215..456694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0408"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR004843:IPR000979; KEGG: pap:PSPA7_0444 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: A6UYF4
FT                   Putative uncharacterized protein; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; TIGRFAM: phosphoesterase,
FT                   MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13546"
FT                   /db_xref="GOA:D7CRQ6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ6"
FT                   /protein_id="ADI13546.1"
FT                   /translation="MTARAEVQSHTVGLIADTHGLLRPEALEALRGVSLIVHAGDIGDR
FT                   GILEVLGRLAPVCAVRGNTDREAWALRLPRYELVNVGALTLYVHHGHEPLDLEPRAAGC
FT                   GVVVSGHTHVPKIETRDGVLYVNPGSAGPKRFDLPVTVARLWVRGQEAEAKLLPL"
     MTARAEVQSH TVGLIADTHG LLRPEALEAL RGVSLIVHAG DIGDRGILEV LGRLAPVCAV        60
     RGNTDREAWA LRLPRYELVN VGALTLYVHH GHEPLDLEPR AAGCGVVVSG HTHVPKIETR       120
     DGVLYVNPGS AGPKRFDLPV TVARLWVRGQ EAEAKLLPL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page