(data stored in ACNUC30630 zone)

EMBL: CP002049.PE404

CP002049.PE404       Location/Qualifiers
FT   CDS             complement(456691..458304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0409"
FT                   /product="Amidohydrolase 3"
FT                   /note="COGs: COG1574 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR013108:IPR011059; KEGG:
FT                   mlo:mll2891 hypothetical protein; PFAM: Amidohydrolase 3;
FT                   SPTR: C8STV8 Amidohydrolase 3; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13547"
FT                   /db_xref="GOA:D7CRQ7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ7"
FT                   /protein_id="ADI13547.1"
FT                   /translation="MPPLDAAADLIITNARAWTLDKSNPRADTVAVKGERILYVGSERE
FT                   AAPLRGPATEIIDGEGRTLLPGLIDSHFHLLWGSLRLDDLQLGGVRGLEALGEAIRGYA
FT                   AAHPESPWLRAQGLAYDVLPGERLTRQHLDALEPHRPMVLTCFDFHTAWCNTAALRAAG
FT                   ILHGAEVPSNAEVVLGDDGLATGELREFEAMELVYRLLPEPSPAEVRDLLRRGMRLANA
FT                   YGITSVHNMNGDLDEFAHYRALDEAGELSLRLYVPFRMYPHTPLSAIEGEAVAMRAYRS
FT                   AKLRAGALKLFMDGVVESYTAFLTEPYAGAAGCGEAIFSAEHAREIAVRAERAGLQVAV
FT                   HAVGDAAVRRALDAFAAARRANGPRDTRHRIEHIELLHPDDVPRFAELGVTASMQPFHC
FT                   TRPERDYLPSWLACIPAARYADAFPWETLRAAGAHLCFGSDWPVVSMNPFLGFDAAVNR
FT                   QPWAEGLPAQAQTLEATLEAYTKGAAFAEFGERDKGQLKAGMLADLALLSADVFALPAE
FT                   RLSTLTAALTVCGGEVVHRG"
     MPPLDAAADL IITNARAWTL DKSNPRADTV AVKGERILYV GSEREAAPLR GPATEIIDGE        60
     GRTLLPGLID SHFHLLWGSL RLDDLQLGGV RGLEALGEAI RGYAAAHPES PWLRAQGLAY       120
     DVLPGERLTR QHLDALEPHR PMVLTCFDFH TAWCNTAALR AAGILHGAEV PSNAEVVLGD       180
     DGLATGELRE FEAMELVYRL LPEPSPAEVR DLLRRGMRLA NAYGITSVHN MNGDLDEFAH       240
     YRALDEAGEL SLRLYVPFRM YPHTPLSAIE GEAVAMRAYR SAKLRAGALK LFMDGVVESY       300
     TAFLTEPYAG AAGCGEAIFS AEHAREIAVR AERAGLQVAV HAVGDAAVRR ALDAFAAARR       360
     ANGPRDTRHR IEHIELLHPD DVPRFAELGV TASMQPFHCT RPERDYLPSW LACIPAARYA       420
     DAFPWETLRA AGAHLCFGSD WPVVSMNPFL GFDAAVNRQP WAEGLPAQAQ TLEATLEAYT       480
     KGAAFAEFGE RDKGQLKAGM LADLALLSAD VFALPAERLS TLTAALTVCG GEVVHRG          537
//

If you have problems or comments...

PBIL Back to PBIL home page