(data stored in ACNUC30630 zone)

EMBL: CP002049.PE405

CP002049.PE405       Location/Qualifiers
FT   CDS             complement(458383..458964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0410"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG0723 Rieske Fe-S protein; InterPro
FT                   IPR005805:IPR017941; KEGG: dge:Dgeo_1251 Rieske (2Fe-2S)
FT                   region; PFAM: Rieske [2Fe-2S] iron-sulphur domain; SPTR:
FT                   Q1IYY7 Rieske (2Fe-2S) region; PFAM: Rieske [2Fe-2S]
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13548"
FT                   /db_xref="GOA:D7CRQ8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ8"
FT                   /protein_id="ADI13548.1"
FT                   /translation="MTETPQTTPTPDAPDATRRRLITWLWRLPVLAAVGATGWGVWEAY
FT                   RVHFSKVTPDDAPTFTPHPPERIGSVADFPEVWSALEFTFAGTAALALRLPEPVPGGLS
FT                   VSGVHLAAFSRLCTHLGCPVSLNRNLEAVAVAFNHRTDQPVLTCPCHLSVFAPLQAGRA
FT                   VSGPARDPLPRVQLSPQGDELFAVGLEAPA"
     MTETPQTTPT PDAPDATRRR LITWLWRLPV LAAVGATGWG VWEAYRVHFS KVTPDDAPTF        60
     TPHPPERIGS VADFPEVWSA LEFTFAGTAA LALRLPEPVP GGLSVSGVHL AAFSRLCTHL       120
     GCPVSLNRNL EAVAVAFNHR TDQPVLTCPC HLSVFAPLQA GRAVSGPARD PLPRVQLSPQ       180
     GDELFAVGLE APA                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page