(data stored in ACNUC30630 zone)

EMBL: CP002049.PE41

CP002049.PE41        Location/Qualifiers
FT   CDS             complement(43486..44058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0041"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: dge:Dgeo_1384 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: Q1IYK5
FT                   Sigma 54 modulation protein/ribosomal protein S30EA;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13184"
FT                   /db_xref="GOA:D7CWU3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU3"
FT                   /protein_id="ADI13184.1"
FT                   /translation="MDIYQMIGRNIEVTDAMRAYAEEKLEKLERFSDHIVDAKVVMSYA
FT                   TDGNPAMPAKVEVQLNVPNGIVRAEESGPDTYAATDLVVEKLERQLRRFKERRLAKRNQ
FT                   EPPPSDLDVAPMEGAGVAADESQEREPAIVRVKRHVMRPMSPEDAALQMEALGHAFFVF
FT                   HNMETDTISVLYRRHDGDYGLIEPANN"
     MDIYQMIGRN IEVTDAMRAY AEEKLEKLER FSDHIVDAKV VMSYATDGNP AMPAKVEVQL        60
     NVPNGIVRAE ESGPDTYAAT DLVVEKLERQ LRRFKERRLA KRNQEPPPSD LDVAPMEGAG       120
     VAADESQERE PAIVRVKRHV MRPMSPEDAA LQMEALGHAF FVFHNMETDT ISVLYRRHDG       180
     DYGLIEPANN                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page