(data stored in ACNUC30630 zone)

EMBL: CP002049.PE410

CP002049.PE410       Location/Qualifiers
FT   CDS             complement(463506..463943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0415"
FT                   /product="CcmE/CycJ protein"
FT                   /note="COGs: COG2332 Cytochrome c-type biogenesis protein
FT                   CcmE; InterPro IPR004329:IPR012340; KEGG: tth:TTC1039
FT                   cytochrome c-type biogenesis protein CcmE; PFAM: CcmE/CycJ
FT                   protein; SPTR: B7A5K9 CcmE/CycJ protein; manually curated;
FT                   PFAM: CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13553"
FT                   /db_xref="GOA:D7CRR3"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR3"
FT                   /protein_id="ADI13553.1"
FT                   /translation="MGGAAIKRLIYSVAGVALLGVAGTFLYQALANSLVYFILPSEYAS
FT                   APESYSGRIRLGGLVEKGTLTFDSDALQLAFDITDSVQSFPVRYGGAPPELLRENTGVV
FT                   VVGSFEDGTFMGDEVLVKHTEVYEPAEGEEIDLDELKEALR"
     MGGAAIKRLI YSVAGVALLG VAGTFLYQAL ANSLVYFILP SEYASAPESY SGRIRLGGLV        60
     EKGTLTFDSD ALQLAFDITD SVQSFPVRYG GAPPELLREN TGVVVVGSFE DGTFMGDEVL       120
     VKHTEVYEPA EGEEIDLDEL KEALR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page