(data stored in ACNUC30630 zone)

EMBL: CP002049.PE42

CP002049.PE42        Location/Qualifiers
FT   CDS             44472..44816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0042"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845:IPR011991; KEGG: ddr:Deide_2p00101
FT                   putative transcriptional regulator, ArsR family; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR;
FT                   SPTR: C1XMQ5 Transcriptional regulator, ArsR family; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13185"
FT                   /db_xref="GOA:D7CX61"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX61"
FT                   /protein_id="ADI13185.1"
FT                   /translation="METLSSRLKALADPVRLAMLDFLLNPVQACLTQADGVCACDFEAG
FT                   LGMTQSAVSHHMKILVQAGFVHAEKHGRWVRYSVNPTVFASVCEALRPYVEASPVPEAA
FT                   PRLAVAGGRS"
     METLSSRLKA LADPVRLAML DFLLNPVQAC LTQADGVCAC DFEAGLGMTQ SAVSHHMKIL        60
     VQAGFVHAEK HGRWVRYSVN PTVFASVCEA LRPYVEASPV PEAAPRLAVA GGRS             114
//

If you have problems or comments...

PBIL Back to PBIL home page