(data stored in ACNUC30630 zone)

EMBL: CP002049.PE425

CP002049.PE425       Location/Qualifiers
FT   CDS             complement(474402..475607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0431"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="InterPro IPR014082; KEGG: ttj:TTHB144 hypothetical
FT                   protein; PFAM: CRISPR-associated protein Cas02710; SPTR:
FT                   C1XW86 CRISPR-associated protein, TIGR02710 family;
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family; PFAM:
FT                   CRISPR-associated protein (Cas_Cas02710); TIGRFAM:
FT                   CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13568"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014082"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS36"
FT                   /protein_id="ADI13568.1"
FT                   /translation="MPASGVAQVLIATVGATPEPIVTAALEHAPERAVFIASQETQQVA
FT                   AQVKEALGLEVYTILLDDAESLSEAYEAAQRALAKALEWEARAITADLTGGTKPMVAGL
FT                   ALALTGQGVTFSYVGGSARDAYGRVQSGSERLRLLEDPTARFFVREWEAFTRAWNGWRF
FT                   REAQSIVALICAQPLSASNARFFRHLSGVCAGLNAWDSFHHDEALGLLQTHLEPALSIA
FT                   EAWRHGAKVRVLGALFARQGELQALTQRQRPTRALLGDLLANAERRAFAGRFDDALARL
FT                   YRGVELAAEVDIAERYGFHLKVAATWPELSPELKRRAGTLLGLKETLDLASDIDLFFGK
FT                   NGTLAQRLRDDYPKQLKPLLARRHESVLAHGLRSVGAGDYEALRAYLEAQGLRAAEGWP
FT                   RW"
     MPASGVAQVL IATVGATPEP IVTAALEHAP ERAVFIASQE TQQVAAQVKE ALGLEVYTIL        60
     LDDAESLSEA YEAAQRALAK ALEWEARAIT ADLTGGTKPM VAGLALALTG QGVTFSYVGG       120
     SARDAYGRVQ SGSERLRLLE DPTARFFVRE WEAFTRAWNG WRFREAQSIV ALICAQPLSA       180
     SNARFFRHLS GVCAGLNAWD SFHHDEALGL LQTHLEPALS IAEAWRHGAK VRVLGALFAR       240
     QGELQALTQR QRPTRALLGD LLANAERRAF AGRFDDALAR LYRGVELAAE VDIAERYGFH       300
     LKVAATWPEL SPELKRRAGT LLGLKETLDL ASDIDLFFGK NGTLAQRLRD DYPKQLKPLL       360
     ARRHESVLAH GLRSVGAGDY EALRAYLEAQ GLRAAEGWPR W                           401
//

If you have problems or comments...

PBIL Back to PBIL home page