(data stored in ACNUC30630 zone)

EMBL: CP002049.PE426

CP002049.PE426       Location/Qualifiers
FT   CDS             complement(477309..478052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0432"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG5551 conserved hypothetical protein;
FT                   InterPro IPR019267:IPR010156; KEGG: tth:TTC1927
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2276; SPTR: B7A9Z1 CRISPR-associated protein Cas6;
FT                   TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   Uncharacterized conserved protein (DUF2276); TIGRFAM:
FT                   CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13569"
FT                   /db_xref="GOA:D7CS37"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS37"
FT                   /protein_id="ADI13569.1"
FT                   /translation="MSLVALVLPLTGAQKPEAVHVRGALYALLKEHAPELHDRQDLKPF
FT                   TVSVGGAAKDHPPFIRLTFLSEPLYTALAPALHDLPRRPLSLGDRTYTVTDVLQEGHPW
FT                   AGATTYPRLFQTPGDADLSLHFATPTVFRRHGANYPLPEPRLVLGSLIERWNLYAPLAV
FT                   PSEVASRLTEGCVPRFFELRSRTVYAHDPFTGFLGRVTFHLRGASADEAHWLAILGRFA
FT                   FYSGVGAKTTLGFGQVRPYRPTPGA"
     MSLVALVLPL TGAQKPEAVH VRGALYALLK EHAPELHDRQ DLKPFTVSVG GAAKDHPPFI        60
     RLTFLSEPLY TALAPALHDL PRRPLSLGDR TYTVTDVLQE GHPWAGATTY PRLFQTPGDA       120
     DLSLHFATPT VFRRHGANYP LPEPRLVLGS LIERWNLYAP LAVPSEVASR LTEGCVPRFF       180
     ELRSRTVYAH DPFTGFLGRV TFHLRGASAD EAHWLAILGR FAFYSGVGAK TTLGFGQVRP       240
     YRPTPGA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page