(data stored in ACNUC30630 zone)

EMBL: CP002049.PE427

CP002049.PE427       Location/Qualifiers
FT   CDS             complement(478075..479034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0433"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008960:IPR015922; KEGG: ttj:TTHA0317
FT                   hypothetical protein; SPTR: C1XR88 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF2223)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13570"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS38"
FT                   /protein_id="ADI13570.1"
FT                   /translation="MLAFVLASLLTLQDPAGDAVGNGTLAAPTASAFRSTDPFDLTRIT
FT                   VPDADTFGVTLEYALIPPADAFPQAITELYVHDADAAARGEPGRAALLPGSGMRLPEGR
FT                   GWHLAFRFVGERVWAFSPEGPAAEDAFPRDVTAALGARVRREGNTLTLTTAAPTPRRFS
FT                   LYGMTGVYDPFSETGWRALRTEPAPWSFSSTEQTVNVLDVLTDAYAQQRAAIDQGVLPE
FT                   IRAPVIREGWLLVAGAGVVVALLGLAARLSVRPDAPTEAPTDTPTDTPTPPTPARVRPR
FT                   VLVVRRPEAPAPQPPPTADTPDEPAAELEEAHAEPQAV"
     MLAFVLASLL TLQDPAGDAV GNGTLAAPTA SAFRSTDPFD LTRITVPDAD TFGVTLEYAL        60
     IPPADAFPQA ITELYVHDAD AAARGEPGRA ALLPGSGMRL PEGRGWHLAF RFVGERVWAF       120
     SPEGPAAEDA FPRDVTAALG ARVRREGNTL TLTTAAPTPR RFSLYGMTGV YDPFSETGWR       180
     ALRTEPAPWS FSSTEQTVNV LDVLTDAYAQ QRAAIDQGVL PEIRAPVIRE GWLLVAGAGV       240
     VVALLGLAAR LSVRPDAPTE APTDTPTDTP TPPTPARVRP RVLVVRRPEA PAPQPPPTAD       300
     TPDEPAAELE EAHAEPQAV                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page