(data stored in ACNUC30630 zone)

EMBL: CP002049.PE429

CP002049.PE429       Location/Qualifiers
FT   CDS             complement(480351..481274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1660 P-loop-containing kinase; InterPro
FT                   IPR005337; KEGG: ddr:Deide_09390 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: C1D1U3 UPF0042
FT                   nucleotide-binding protein Deide_09390; PFAM: P-loop ATPase
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13572"
FT                   /db_xref="GOA:D7CS40"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS40"
FT                   /protein_id="ADI13572.1"
FT                   /translation="MRFVVLTGLSGAGRTTALAALEDLGYFTADNLPPALWSALVEQAQ
FT                   TRGREGEAARLAVGVGIRTEAFLDRLPEALAQLQARGIRPEIVFLDASNETLIRRYNFT
FT                   RRTHPLGYAPLIQDIAKEREVLGELRSVADTVLDTSNFSARALTEELWARFGADRRFRL
FT                   RLTSFGFKRGVPIDADNVFDLRSLPNPYYDPALRVKDGRDADVAAYVFSAEGMAFYTEL
FT                   REFVRLLAGRALVTGRSSYTVALGCTGGQHRSVAFAERLKHDLAEAFATYAEHRDLAQA
FT                   LAEHAPAAGAPESGAQGADTAQVNRG"
     MRFVVLTGLS GAGRTTALAA LEDLGYFTAD NLPPALWSAL VEQAQTRGRE GEAARLAVGV        60
     GIRTEAFLDR LPEALAQLQA RGIRPEIVFL DASNETLIRR YNFTRRTHPL GYAPLIQDIA       120
     KEREVLGELR SVADTVLDTS NFSARALTEE LWARFGADRR FRLRLTSFGF KRGVPIDADN       180
     VFDLRSLPNP YYDPALRVKD GRDADVAAYV FSAEGMAFYT ELREFVRLLA GRALVTGRSS       240
     YTVALGCTGG QHRSVAFAER LKHDLAEAFA TYAEHRDLAQ ALAEHAPAAG APESGAQGAD       300
     TAQVNRG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page