(data stored in ACNUC30630 zone)

EMBL: CP002049.PE430

CP002049.PE430       Location/Qualifiers
FT   CDS             complement(481324..481986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0436"
FT                   /product="Sporulation domain protein"
FT                   /note="InterPro IPR007730; KEGG: mxa:MXAN_3502 adventurous
FT                   gliding motility protein AgmI; PFAM: Sporulation domain
FT                   protein; SPTR: Q1D6M7 Cell division protein; PFAM:
FT                   Sporulation related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13573"
FT                   /db_xref="GOA:D7CS41"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS41"
FT                   /protein_id="ADI13573.1"
FT                   /translation="MRAALCCFCFALGLAWAQPPSGAFALQVFAFGDPAHAQRVAERLR
FT                   TYGFDAYTETPPGSRWVQVRIGCFGARADAEGLLADVRARVSADALIVPFSPGAGASVC
FT                   AVRELGFIPPPRWELAHSGAERVSFRVGDPPRYLVFDGRWRVAQSDAETHAPSAGLPAG
FT                   TLHAHYRATRSRGRPLVRADLAGGSLLIAAGELLWTSRGAAVVQLGQEVFALRLVLP"
     MRAALCCFCF ALGLAWAQPP SGAFALQVFA FGDPAHAQRV AERLRTYGFD AYTETPPGSR        60
     WVQVRIGCFG ARADAEGLLA DVRARVSADA LIVPFSPGAG ASVCAVRELG FIPPPRWELA       120
     HSGAERVSFR VGDPPRYLVF DGRWRVAQSD AETHAPSAGL PAGTLHAHYR ATRSRGRPLV       180
     RADLAGGSLL IAAGELLWTS RGAAVVQLGQ EVFALRLVLP                             220
//

If you have problems or comments...

PBIL Back to PBIL home page