(data stored in ACNUC30630 zone)

EMBL: CP002049.PE446

CP002049.PE446       Location/Qualifiers
FT   CDS             496695..497369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0452"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: rbi:RB2501_13489 putative
FT                   secreted protein; PFAM: PKD domain containing protein;
FT                   SMART: PKD domain containing protein; SPTR: A4CKE5 Putative
FT                   secreted protein; PFAM: PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13589"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS57"
FT                   /protein_id="ADI13589.1"
FT                   /translation="MATSRLLASRRVATRRVASVALVGLFLGACGPLPGGSGALPDPVI
FT                   ELEAENARGEWPLVVTLTARTAELARPVTAYRWDFGAGEAIGAPTEGGARRTVVYTEAG
FT                   TYTARVEVVAGAQTGEASTQIEVLPRSAPRDINNLPPTVTLEADVTEGSAPLEVTLSAT
FT                   AEDPNADALTTTLFFGDGTRTLASEATHVYTEPGTYVATAVVTDGRGGVAAADVVITVA
FT                   SP"
     MATSRLLASR RVATRRVASV ALVGLFLGAC GPLPGGSGAL PDPVIELEAE NARGEWPLVV        60
     TLTARTAELA RPVTAYRWDF GAGEAIGAPT EGGARRTVVY TEAGTYTARV EVVAGAQTGE       120
     ASTQIEVLPR SAPRDINNLP PTVTLEADVT EGSAPLEVTL SATAEDPNAD ALTTTLFFGD       180
     GTRTLASEAT HVYTEPGTYV ATAVVTDGRG GVAAADVVIT VASP                        224
//

If you have problems or comments...

PBIL Back to PBIL home page