(data stored in ACNUC30630 zone)

EMBL: CP002049.PE452

CP002049.PE452       Location/Qualifiers
FT   CDS             complement(502833..503144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0458"
FT                   /product="Bor family protein"
FT                   /note="InterPro IPR010438; KEGG: eca:ECA2067 lipoprotein;
FT                   PFAM: Bor family protein; SPTR: Q1ZW04 Putative
FT                   uncharacterized protein; PFAM: Bor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13595"
FT                   /db_xref="InterPro:IPR010438"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS63"
FT                   /protein_id="ADI13595.1"
FT                   /translation="MKRPSAVLFAGVLTVTLLAGCATQSFDINPPLTPTSPGQATVEES
FT                   QPFFVGGVSQSTLIDAAAVCGGADRVARVETETTVLDSILSFVTGGIYSPRTARVYCL"
     MKRPSAVLFA GVLTVTLLAG CATQSFDINP PLTPTSPGQA TVEESQPFFV GGVSQSTLID        60
     AAAVCGGADR VARVETETTV LDSILSFVTG GIYSPRTARV YCL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page