(data stored in ACNUC30630 zone)

EMBL: CP002049.PE454

CP002049.PE454       Location/Qualifiers
FT   CDS             506973..508796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0460"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR009080:IPR
FT                   014729:IPR001278; KEGG: dge:Dgeo_1036 arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain protein;
FT                   arginyl tRNA synthetase domain protein; Arginyl-tRNA
FT                   synthetase, class Ic, core; PRIAM: Arginine--tRNA ligase;
FT                   SPTR: Q1IZJ9 Arginyl-tRNA synthetase; TIGRFAM: arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain; Arginyl
FT                   tRNA synthetase N terminal domain; tRNA synthetases class I
FT                   (R); TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13597"
FT                   /db_xref="GOA:D7CS65"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS65"
FT                   /protein_id="ADI13597.1"
FT                   /translation="MDVKIQLKAALERAVRALGTEAEVTVQAVPEGKAGDYGSPVAFGL
FT                   ARVLRKNPAAIAQELVERLELPAGVARAEAVGPYLNFHLDPGAFVRGVVEGELALPERG
FT                   KKVIVEHTSVNPNKEAHVGHLRNIVLGDAVARILRAAGYEVEVQNYIDDTGRQAAESLF
FT                   AVGYFGATYDGAEKYDHWLGKLYVRLTQAKETDAETIERGVSQTMHRLERGELRGEIER
FT                   VLRAQLETYHALGAEYDLLVWESDIVKSGFLARALEVLKRSEDVFTPSEGKYAGALVMD
FT                   VSKLIPGLEEPLVVLVRSDGNAMYVAKDIGTQFWKVGLFEGLRFRRFHRQPSGKPLYTS
FT                   APEGDLHPDGRTFAHADAVVNVIDTRQSHPQMIVKAALEMADAARGADASHHLAYEVVT
FT                   LEGQAMSGRKGITLAIDTVLAEAAKRARAVVEEKNPGLKAVDEVARQVGVGALRFAMLK
FT                   SEARRVIDFRWEQALSLQGDSAPYVQYAHARACSILRAACEAGVGESGAVWERLGPLEV
FT                   KLAQELARLPEIIGSAARDFAPHLVGQYCLDVATAWNAYYNHRGADGKPDTQVLKAEPG
FT                   LREARLALVRKVKETLATSLGLLGIEAPEEM"
     MDVKIQLKAA LERAVRALGT EAEVTVQAVP EGKAGDYGSP VAFGLARVLR KNPAAIAQEL        60
     VERLELPAGV ARAEAVGPYL NFHLDPGAFV RGVVEGELAL PERGKKVIVE HTSVNPNKEA       120
     HVGHLRNIVL GDAVARILRA AGYEVEVQNY IDDTGRQAAE SLFAVGYFGA TYDGAEKYDH       180
     WLGKLYVRLT QAKETDAETI ERGVSQTMHR LERGELRGEI ERVLRAQLET YHALGAEYDL       240
     LVWESDIVKS GFLARALEVL KRSEDVFTPS EGKYAGALVM DVSKLIPGLE EPLVVLVRSD       300
     GNAMYVAKDI GTQFWKVGLF EGLRFRRFHR QPSGKPLYTS APEGDLHPDG RTFAHADAVV       360
     NVIDTRQSHP QMIVKAALEM ADAARGADAS HHLAYEVVTL EGQAMSGRKG ITLAIDTVLA       420
     EAAKRARAVV EEKNPGLKAV DEVARQVGVG ALRFAMLKSE ARRVIDFRWE QALSLQGDSA       480
     PYVQYAHARA CSILRAACEA GVGESGAVWE RLGPLEVKLA QELARLPEII GSAARDFAPH       540
     LVGQYCLDVA TAWNAYYNHR GADGKPDTQV LKAEPGLREA RLALVRKVKE TLATSLGLLG       600
     IEAPEEM                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page