(data stored in ACNUC30630 zone)

EMBL: CP002049.PE468

CP002049.PE468       Location/Qualifiers
FT   CDS             complement(525391..527568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0474"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="COGs: COG0608 Single-stranded DNA-specific
FT                   exonuclease; InterPro IPR001667:IPR003156:IPR004610; KEGG:
FT                   dge:Dgeo_1599 single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; SPTR: Q1IXZ0
FT                   Single-stranded-DNA-specific exonuclease RecJ; TIGRFAM:
FT                   single-stranded-DNA-specific exonuclease RecJ; PFAM: DHH
FT                   family; DHHA1 domain; TIGRFAM: single-stranded-DNA-specific
FT                   exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13611"
FT                   /db_xref="GOA:D7CS79"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS79"
FT                   /protein_id="ADI13611.1"
FT                   /translation="MRPSAPPHPTAPAARWAVRPSAPPAEVARLVRAFSLPPLVASVLW
FT                   ARGLRSPEALQPPFERTRIPALATAAERLAEALARGKRILIHGDYDADGISGTAVLTLG
FT                   LRALGGRVTPFIPNRLRDGYGVHPARVAEHAAGADLFITVDCGISNRAEVAALQAAGVE
FT                   VIVTDHHHPGQVLPDCLTVHPSLSPYAKKGLPELTGAGVAYHLLWALHEHLGLEAPVEY
FT                   SDLATIGTVADVAPLMGENRALVTAGLAQLARSRWPGLRAMMARTLSHGRAPSAREVAF
FT                   VLAPRLNAAGRLGEADLGLELLTTASERRALELASYLDARNADRRKVQDAMLGEALKLV
FT                   DPEAPALVLERPSWHPGVMGIVASKLLERFYKPVFIIAQGKGSVRSTPGISAVGGLEYA
FT                   RDLLERFGGHSQAAGFAIREGCVEAFRERVYDYARQHPTPRPELVADTLLAPDEIDTDL
FT                   YRALCTLEPYGEGHPAPRFALCAPLEGVGCMGEGGKHLNLRVGGVRGVAWDRGADAPAL
FT                   RAAGVINAAVTLRENTWQGKTQLELLADDVRPAAPLELSTPSAVRRPLYRGPPPEGVDA
FT                   RWVREVPLSADLLQLTAPLAALVRRGEPLSFDLPEAELGRLAALPLPPTLSEVRRAFVC
FT                   LRRGTPLPADTPKAQLCRRILEELELVGPSGHALRGQKRDPYSSESFVKGLLERYKLQG
FT                   FLKAYRALSDVAFAETVWTLFGPSEAGPKRT"
     MRPSAPPHPT APAARWAVRP SAPPAEVARL VRAFSLPPLV ASVLWARGLR SPEALQPPFE        60
     RTRIPALATA AERLAEALAR GKRILIHGDY DADGISGTAV LTLGLRALGG RVTPFIPNRL       120
     RDGYGVHPAR VAEHAAGADL FITVDCGISN RAEVAALQAA GVEVIVTDHH HPGQVLPDCL       180
     TVHPSLSPYA KKGLPELTGA GVAYHLLWAL HEHLGLEAPV EYSDLATIGT VADVAPLMGE       240
     NRALVTAGLA QLARSRWPGL RAMMARTLSH GRAPSAREVA FVLAPRLNAA GRLGEADLGL       300
     ELLTTASERR ALELASYLDA RNADRRKVQD AMLGEALKLV DPEAPALVLE RPSWHPGVMG       360
     IVASKLLERF YKPVFIIAQG KGSVRSTPGI SAVGGLEYAR DLLERFGGHS QAAGFAIREG       420
     CVEAFRERVY DYARQHPTPR PELVADTLLA PDEIDTDLYR ALCTLEPYGE GHPAPRFALC       480
     APLEGVGCMG EGGKHLNLRV GGVRGVAWDR GADAPALRAA GVINAAVTLR ENTWQGKTQL       540
     ELLADDVRPA APLELSTPSA VRRPLYRGPP PEGVDARWVR EVPLSADLLQ LTAPLAALVR       600
     RGEPLSFDLP EAELGRLAAL PLPPTLSEVR RAFVCLRRGT PLPADTPKAQ LCRRILEELE       660
     LVGPSGHALR GQKRDPYSSE SFVKGLLERY KLQGFLKAYR ALSDVAFAET VWTLFGPSEA       720
     GPKRT                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page