(data stored in ACNUC30630 zone)

EMBL: CP002049.PE469

CP002049.PE469       Location/Qualifiers
FT   CDS             complement(527572..528015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_07570 hypothetical protein; SPTR:
FT                   A5P897 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1049)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13612"
FT                   /db_xref="GOA:D7CS80"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS80"
FT                   /protein_id="ADI13612.1"
FT                   /translation="MKIFRVIQLLALGALIGYLVVLHNVNPQIVILPFFISLPVSWVVG
FT                   ASLLLGFLVGWLAFSGHAWRLARENRALRQRLSKAGAVLEPALTERDTARPTQVRRTPP
FT                   PRPERDAEPLSPEDLSSAAENHAPRRGWRFGSRNAPTDTDEER"
     MKIFRVIQLL ALGALIGYLV VLHNVNPQIV ILPFFISLPV SWVVGASLLL GFLVGWLAFS        60
     GHAWRLAREN RALRQRLSKA GAVLEPALTE RDTARPTQVR RTPPPRPERD AEPLSPEDLS       120
     SAAENHAPRR GWRFGSRNAP TDTDEER                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page