(data stored in ACNUC30630 zone)

EMBL: CP002049.PE47

CP002049.PE47        Location/Qualifiers
FT   CDS             complement(49011..52331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0047"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterProIPR006141:IPR014016:IPR014017:IPR000212:IPR 003586;
FT                   KEGG: dge:Dgeo_0868 UvrD/REP helicase; PFAM: UvrD/REP
FT                   helicase; SMART: Hedgehog/intein hint domain protein; SPTR:
FT                   B4VQT2 UvrD/REP helicase subfamily; PFAM: UvrD/REP
FT                   helicase; TIGRFAM: intein N-terminal splicing region;
FT                   intein C-terminal splicing region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13190"
FT                   /db_xref="GOA:D7CX66"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX66"
FT                   /protein_id="ADI13190.1"
FT                   /translation="MPETVSDHPLLAVLNEEQRAAAEHFQGPALVLAGAGSGKTRTVVH
FT                   RIAYLMDAHEVYPTEILAVTFTNKAAGELKERVAHLMGEAAKDLWVSTFHSACLRILRA
FT                   YGGLIGLEPGFAIYDDTDQLEVLKEILERVTGLGDANPRVLRALIDRAKSNLWTPAELA
FT                   REGERVFGGMVAGLPLELVAEVYERYSSRLRSVNAVDFNDILGRTVELFERFPEVLEKV
FT                   QQRAVFIHVDEYQDTNTAQYRLTRLLANKYANLMVVGDPDQCLPPETRIPTRRGCLPIA
FT                   CVQEGDEVLGTGGGLQPTWGHVTTVKRGRYRGPMWEVRVGGRVVRGTPHHLVLARLDPE
FT                   AGFYYVYLMYREDRGYRLGLTKSLRANDFGQDEVGFRVRLAQENGDKLWVLRVCQTYAE
FT                   ARYWEARFAAEYGLPTLVFHGVGRRLKMDEGWIARLYQDVDTTASAARLMAQLHLHPDF
FT                   PHYRPQNGLRRQSVNLVMFQDFRHGGVGYHRVQWSSIRADLAARLLAAGYPVRSNGRGG
FT                   YRTEICRKSYRDALAFARGFAEAGGLELQRKAYIDGRMYHVTPLAHLHPGMRVLVKREQ
FT                   SLEEAVVETVSQVAYDGPVFDLEVTPTHTYLANGMLVHNSIYAFRGADVRNILDFREDF
FT                   PDAAVYRLELNYRSVASVLELANAVIAPNEGRLEKRLRPVKGAGDKVRLYRAADHRAEA
FT                   DFVARQIERLQAERGLSAKDFTVLYRTNSQSRVLEEALRRAGIPAKIVGGVGFYERREV
FT                   KDILSYARAALNPADDVAWRRVLNRPKRGIGKTSEETLVAFAAKRGIRFSEALRRAEEP
FT                   LRGTPALKRIGEFVALMDDLREAAETLPAAQFLQAAIDQSGYLQALKDEKSFEAQGRIE
FT                   NLDELVNAVAEWQEETGGSIGEFLDEAALLASVDDRAVKAVNQGQAPEEAVTLMTLHNA
FT                   KGLEFPVVFLVGLEENLIPHRSSLASLQEIEEERRLLYVGVTRAQELLFLVHCESRMSF
FT                   GRTEFARPSRFLEDIPKGMLQEIDVFGQELHAERLSKYSRAVWAPPKLGATGASAPASA
FT                   EDGGGVSFRGGERVKHPKFGLGTVVGVSGEGARAEVTVVFQEAGPKRLLFKYANLTRA"
     MPETVSDHPL LAVLNEEQRA AAEHFQGPAL VLAGAGSGKT RTVVHRIAYL MDAHEVYPTE        60
     ILAVTFTNKA AGELKERVAH LMGEAAKDLW VSTFHSACLR ILRAYGGLIG LEPGFAIYDD       120
     TDQLEVLKEI LERVTGLGDA NPRVLRALID RAKSNLWTPA ELAREGERVF GGMVAGLPLE       180
     LVAEVYERYS SRLRSVNAVD FNDILGRTVE LFERFPEVLE KVQQRAVFIH VDEYQDTNTA       240
     QYRLTRLLAN KYANLMVVGD PDQCLPPETR IPTRRGCLPI ACVQEGDEVL GTGGGLQPTW       300
     GHVTTVKRGR YRGPMWEVRV GGRVVRGTPH HLVLARLDPE AGFYYVYLMY REDRGYRLGL       360
     TKSLRANDFG QDEVGFRVRL AQENGDKLWV LRVCQTYAEA RYWEARFAAE YGLPTLVFHG       420
     VGRRLKMDEG WIARLYQDVD TTASAARLMA QLHLHPDFPH YRPQNGLRRQ SVNLVMFQDF       480
     RHGGVGYHRV QWSSIRADLA ARLLAAGYPV RSNGRGGYRT EICRKSYRDA LAFARGFAEA       540
     GGLELQRKAY IDGRMYHVTP LAHLHPGMRV LVKREQSLEE AVVETVSQVA YDGPVFDLEV       600
     TPTHTYLANG MLVHNSIYAF RGADVRNILD FREDFPDAAV YRLELNYRSV ASVLELANAV       660
     IAPNEGRLEK RLRPVKGAGD KVRLYRAADH RAEADFVARQ IERLQAERGL SAKDFTVLYR       720
     TNSQSRVLEE ALRRAGIPAK IVGGVGFYER REVKDILSYA RAALNPADDV AWRRVLNRPK       780
     RGIGKTSEET LVAFAAKRGI RFSEALRRAE EPLRGTPALK RIGEFVALMD DLREAAETLP       840
     AAQFLQAAID QSGYLQALKD EKSFEAQGRI ENLDELVNAV AEWQEETGGS IGEFLDEAAL       900
     LASVDDRAVK AVNQGQAPEE AVTLMTLHNA KGLEFPVVFL VGLEENLIPH RSSLASLQEI       960
     EEERRLLYVG VTRAQELLFL VHCESRMSFG RTEFARPSRF LEDIPKGMLQ EIDVFGQELH      1020
     AERLSKYSRA VWAPPKLGAT GASAPASAED GGGVSFRGGE RVKHPKFGLG TVVGVSGEGA      1080
     RAEVTVVFQE AGPKRLLFKY ANLTRA                                           1106
//

If you have problems or comments...

PBIL Back to PBIL home page