(data stored in ACNUC30630 zone)

EMBL: CP002049.PE470

CP002049.PE470       Location/Qualifiers
FT   CDS             complement(528079..528981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0476"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR001440:IPR013105:IPR019734:IPR013026:IPR
FT                   011990; KEGG: dge:Dgeo_2293 tetratricopeptide TPR_2; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: Q1IVZ7 Tetratricopeptide
FT                   TPR_2; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS81"
FT                   /protein_id="ADI13613.1"
FT                   /translation="MRRLYTATLYALLAALPAAMTAPPASAQITTLTQPLPAEAREVLE
FT                   GARERTREALKTYEAPYRPDQPLFREALSLARRAVELAPDNPEALRFLAELNGVTGFYG
FT                   PAFAAWERFVAAGGVLDAAALDQLVRAGTQVGYARYQQGDLEGALAAYERVADLAPERP
FT                   LAHRWRGRILLELERPQRALEAWETVLRLRPGDAAAEHFADLAAAGVRYGLPAARAFYD
FT                   GVAHYEAGRRERARERFAEAARLNPAYAEAWAYVGRVAFEAGDYREAERAYSEASALEP
FT                   DNATYRYFLAEARRRAEGS"
     MRRLYTATLY ALLAALPAAM TAPPASAQIT TLTQPLPAEA REVLEGARER TREALKTYEA        60
     PYRPDQPLFR EALSLARRAV ELAPDNPEAL RFLAELNGVT GFYGPAFAAW ERFVAAGGVL       120
     DAAALDQLVR AGTQVGYARY QQGDLEGALA AYERVADLAP ERPLAHRWRG RILLELERPQ       180
     RALEAWETVL RLRPGDAAAE HFADLAAAGV RYGLPAARAF YDGVAHYEAG RRERARERFA       240
     EAARLNPAYA EAWAYVGRVA FEAGDYREAE RAYSEASALE PDNATYRYFL AEARRRAEGS       300
//

If you have problems or comments...

PBIL Back to PBIL home page