(data stored in ACNUC30630 zone)

EMBL: CP002049.PE476

CP002049.PE476       Location/Qualifiers
FT   CDS             complement(533222..533503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_04g035660; hypothetical protein;
FT                   SPTR: C5XUD5 Putative uncharacterized protein Sb04g035660"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13619"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS87"
FT                   /protein_id="ADI13619.1"
FT                   /translation="MRFVRRFCLLATLAALTACGPNTQVGDTTRLDGPHNVQQAGVIVP
FT                   QEGQGQRAAEVAAAKARVPYQYREKNNPSLFAFGVNLNPGSNRSTDRD"
     MRFVRRFCLL ATLAALTACG PNTQVGDTTR LDGPHNVQQA GVIVPQEGQG QRAAEVAAAK        60
     ARVPYQYREK NNPSLFAFGV NLNPGSNRST DRD                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page