(data stored in ACNUC30630 zone)

EMBL: CP002049.PE491

CP002049.PE491       Location/Qualifiers
FT   CDS             547747..549015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0497"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="InterPro IPR006652:IPR011043:IPR015915; KEGG:
FT                   xcb:XC_4204 ring canal kelch-like protein; PFAM: Kelch
FT                   repeat-containing protein; SPTR: C1XWE6 Uncharacterized
FT                   conserved protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13634"
FT                   /db_xref="GOA:D7CSA2"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR030104"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA2"
FT                   /protein_id="ADI13634.1"
FT                   /translation="MNRFATRPHRSWRALLWAPLGLLSACYAPGGPTPDNRPPTVSAGG
FT                   DRTVTLPADGVLLAGRAADPDGDPLTALWAQLAGPAEVTFADASALETSARFPEAGAYT
FT                   LELSVTDGQASARDQAVITVEPGAGGAGAWRALPESAAPRQEVSYVQLGGRFYLAGGST
FT                   LHEVYDPVARTWTEVAPLPRNLDHIQGVAVGGKILYIGGNVGGDLRVETDTVYIYDPET
FT                   DTFTEGSPMPRGRGAGGVAVHDGLIYYAGGLNGFVARTWFDVYDPVADTWTALPDMPNP
FT                   RDHFHAVVLDGVFYAIGGREARINATTPAVDAFDIASGTWTTLDTELPTERGGFAAAVL
FT                   GDEILVIGGEGGGNTYEEVEAYNPRTNTWRRLAPMPTPRHGVQAAVCNGGVYLAAGGVV
FT                   QGIGPSSAHEVFFVGEPRPCEAP"
     MNRFATRPHR SWRALLWAPL GLLSACYAPG GPTPDNRPPT VSAGGDRTVT LPADGVLLAG        60
     RAADPDGDPL TALWAQLAGP AEVTFADASA LETSARFPEA GAYTLELSVT DGQASARDQA       120
     VITVEPGAGG AGAWRALPES AAPRQEVSYV QLGGRFYLAG GSTLHEVYDP VARTWTEVAP       180
     LPRNLDHIQG VAVGGKILYI GGNVGGDLRV ETDTVYIYDP ETDTFTEGSP MPRGRGAGGV       240
     AVHDGLIYYA GGLNGFVART WFDVYDPVAD TWTALPDMPN PRDHFHAVVL DGVFYAIGGR       300
     EARINATTPA VDAFDIASGT WTTLDTELPT ERGGFAAAVL GDEILVIGGE GGGNTYEEVE       360
     AYNPRTNTWR RLAPMPTPRH GVQAAVCNGG VYLAAGGVVQ GIGPSSAHEV FFVGEPRPCE       420
     AP                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page