(data stored in ACNUC30630 zone)

EMBL: CP002049.PE502

CP002049.PE502       Location/Qualifiers
FT   CDS             560316..561389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0508"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="COGs: COG2008 Threonine aldolase; InterPro
FT                   IPR001597:IPR015424:IPR015421:IPR015422; KEGG:
FT                   dge:Dgeo_1451 threonine aldolase; PFAM: aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; PRIAM: Threonine
FT                   aldolase; SPTR: Q1IYD8 Threonine aldolase; manually
FT                   curated; PFAM: Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13645"
FT                   /db_xref="GOA:D7CSB3"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB3"
FT                   /protein_id="ADI13645.1"
FT                   /translation="MPRRPNDAPTDARPIDRRPIDLRSDTVTRPTPAMRRAMAEAEVGD
FT                   DVYGEDPTVNRLQEVLAERAGFEAGLLMPTGTMSNQVAIAVHTRRGEEVIVPEGAHVYE
FT                   YELGSMAVVSGALPRTIPAPLGVPEAAAVRAAVHRSVHQAPTGLIVLENTHNRAGGTVV
FT                   PLGRCAEIATVAREEGLPLHLDGARAFNAAAALGVSLAEVCRGFDSASLCLSKGLAAPV
FT                   GTVLLGSTAFIREAHRYRKLLGGGMRQAGVVAAAGLVALDEMSARLAEDHARARALAEG
FT                   LVRLGVSVDLAAVQTNMVYLTVPDAPALAARLARKGVLCGALGPQSVRMVTHYEIGDDD
FT                   VARTLEAVEACLEEARV"
     MPRRPNDAPT DARPIDRRPI DLRSDTVTRP TPAMRRAMAE AEVGDDVYGE DPTVNRLQEV        60
     LAERAGFEAG LLMPTGTMSN QVAIAVHTRR GEEVIVPEGA HVYEYELGSM AVVSGALPRT       120
     IPAPLGVPEA AAVRAAVHRS VHQAPTGLIV LENTHNRAGG TVVPLGRCAE IATVAREEGL       180
     PLHLDGARAF NAAAALGVSL AEVCRGFDSA SLCLSKGLAA PVGTVLLGST AFIREAHRYR       240
     KLLGGGMRQA GVVAAAGLVA LDEMSARLAE DHARARALAE GLVRLGVSVD LAAVQTNMVY       300
     LTVPDAPALA ARLARKGVLC GALGPQSVRM VTHYEIGDDD VARTLEAVEA CLEEARV          357
//

If you have problems or comments...

PBIL Back to PBIL home page