(data stored in ACNUC30630 zone)

EMBL: CP002049.PE51

CP002049.PE51        Location/Qualifiers
FT   CDS             55170..56282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0051"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components;
FT                   InterProIPR003439:IPR005893:IPR013611:IPR008995:IPR
FT                   003593:IPR017871; KEGG: sti:Sthe_1276 spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase; SPTR: D1C394 Spermidine/putrescine ABC transporter
FT                   ATPase subunit; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter; TOBE
FT                   domain; TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13194"
FT                   /db_xref="GOA:D7CX70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX70"
FT                   /protein_id="ADI13194.1"
FT                   /translation="MQPAVELREVTKAYADPRGAGTVRAMDAVSLRIDEGGFFALLGPS
FT                   GCGKTTTLRSIAGFEQPDSGAVLIRGRPVQGIPPFHRPVNTVFQDYALFPHMSVLQNVM
FT                   FGLKMAKVPAREARRRAEEALELVHLPHVGARRPSQLSGGQRQRVALARALVNRPAVLL
FT                   LDEPLGALDLKLRKAMQFELKRMQQQVGITFVFVTHDQEEAMAMADHIAVMDRGRVLQV
FT                   GTPAEIYEHPVNRFVADFIGETNFLEGTLEASGPVGHFRLADGRTLPVVLGAAAPTSGP
FT                   ATLAVRPERIRLTRATHGTGAGGVRLAARVTEVHYLGTDTRYHLVSGSATLSVRQPNTG
FT                   GQLGAEGRFAPGDEVVAWWQPDGAAVLRPE"
     MQPAVELREV TKAYADPRGA GTVRAMDAVS LRIDEGGFFA LLGPSGCGKT TTLRSIAGFE        60
     QPDSGAVLIR GRPVQGIPPF HRPVNTVFQD YALFPHMSVL QNVMFGLKMA KVPAREARRR       120
     AEEALELVHL PHVGARRPSQ LSGGQRQRVA LARALVNRPA VLLLDEPLGA LDLKLRKAMQ       180
     FELKRMQQQV GITFVFVTHD QEEAMAMADH IAVMDRGRVL QVGTPAEIYE HPVNRFVADF       240
     IGETNFLEGT LEASGPVGHF RLADGRTLPV VLGAAAPTSG PATLAVRPER IRLTRATHGT       300
     GAGGVRLAAR VTEVHYLGTD TRYHLVSGSA TLSVRQPNTG GQLGAEGRFA PGDEVVAWWQ       360
     PDGAAVLRPE                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page