(data stored in ACNUC30630 zone)

EMBL: CP002049.PE56

CP002049.PE56        Location/Qualifiers
FT   CDS             61421..62080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tro:trd_A0513 hypothetical protein; SPTR:
FT                   B9L3Z9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13199"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX75"
FT                   /protein_id="ADI13199.1"
FT                   /translation="MTLTAAQTLRRSALITLYLLALSLLPWAAAQLTVRYDGGPTGGFE
FT                   AFIVLQEAIAFELDGEAAGLYVVARRGDEVLLDTSVALEPVVSGRVAVGMITVPIFGMC
FT                   EGGPTLFIQVQTTKVEGSGSRSLTGCLETSGGYLERTVASGPGTFVATAPLDRWIALQA
FT                   LLTPEAYTDTVLGEDAVTFFAFFGREDPARLGAPYPPLPDVRTFDELQALALFPAP"
     MTLTAAQTLR RSALITLYLL ALSLLPWAAA QLTVRYDGGP TGGFEAFIVL QEAIAFELDG        60
     EAAGLYVVAR RGDEVLLDTS VALEPVVSGR VAVGMITVPI FGMCEGGPTL FIQVQTTKVE       120
     GSGSRSLTGC LETSGGYLER TVASGPGTFV ATAPLDRWIA LQALLTPEAY TDTVLGEDAV       180
     TFFAFFGRED PARLGAPYPP LPDVRTFDEL QALALFPAP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page