(data stored in ACNUC30630 zone)

EMBL: CP002049.PE63

CP002049.PE63        Location/Qualifiers
FT   CDS             complement(68492..69571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0063"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COGs: COG0002 Acetylglutamate semialdehyde
FT                   dehydrogenase; InterPro
FT                   IPR000706:IPR000534:IPR012280:IPR016040; KEGG: ttj:TTHA1197
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; PRIAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; SPTR: Q5SJ17
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, dimerisation domain;
FT                   Semialdehyde dehydrogenase, NAD binding domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13206"
FT                   /db_xref="GOA:D7CX82"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX82"
FT                   /protein_id="ADI13206.1"
FT                   /translation="MTRLKVGVLGASGYGGAELLRRLVTHPFVTVSGLASRQFAGQAVA
FT                   ACWPQLAGAALPAFEDAEAVIAGCDVLFCATPHGETAPFVQRALAAGKRVVDLSADFRL
FT                   APKDYAAWYGPHPYPEGCARAVYGLTELHREELRGAELVAVPGCNCTAGNLALAPLALH
FT                   GLLGEHVTVNVLTGVSGAGRSAALGFHFPELNENARPYKAGGTHRHTAELEDTLGRVAA
FT                   FGRQVKTRGDFARPTVSFTPHLVPMTRGILATCTVRPDPEHPEAAGLSTAALLERYEDF
FT                   YRGEPLVTVQEDLPQTKAVSGSDRTLVSVRYDKRSGTVTAFAALDNLGKGAAGGAVQAF
FT                   NAAHGFGETLGLFTQGVWP"
     MTRLKVGVLG ASGYGGAELL RRLVTHPFVT VSGLASRQFA GQAVAACWPQ LAGAALPAFE        60
     DAEAVIAGCD VLFCATPHGE TAPFVQRALA AGKRVVDLSA DFRLAPKDYA AWYGPHPYPE       120
     GCARAVYGLT ELHREELRGA ELVAVPGCNC TAGNLALAPL ALHGLLGEHV TVNVLTGVSG       180
     AGRSAALGFH FPELNENARP YKAGGTHRHT AELEDTLGRV AAFGRQVKTR GDFARPTVSF       240
     TPHLVPMTRG ILATCTVRPD PEHPEAAGLS TAALLERYED FYRGEPLVTV QEDLPQTKAV       300
     SGSDRTLVSV RYDKRSGTVT AFAALDNLGK GAAGGAVQAF NAAHGFGETL GLFTQGVWP        359
//

If you have problems or comments...

PBIL Back to PBIL home page