(data stored in ACNUC30630 zone)

EMBL: CP002049.PE69

CP002049.PE69        Location/Qualifiers
FT   CDS             complement(73398..73913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0069"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro IPR011961:IPR002676:IPR011033; KEGG:
FT                   ttj:TTHA1033 16S rRNA-processing protein RimM; PFAM: RimM
FT                   protein; SPTR: Q5SJH5 Ribosome maturation factor rimM;
FT                   TIGRFAM: 16S rRNA processing protein RimM; PFAM: RimM
FT                   N-terminal domain; TIGRFAM: 16S rRNA processing protein
FT                   RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13212"
FT                   /db_xref="GOA:D7CX88"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX88"
FT                   /protein_id="ADI13212.1"
FT                   /translation="MALAPPEGSVLLGTLGKTFQLQGGLRFYALGEAEAAAIAALQRVF
FT                   VAGFGERALARVRPVGAQQIVYFVGVDTPQAAKALVNADVYAPRAALPELETGFYVDLL
FT                   LGLPVRLGGEVIGEVVEVIPKATALGQDLLVVDTGESEHLIPLQADYVHLHETHVQLTN
FT                   PPEGLLEP"
     MALAPPEGSV LLGTLGKTFQ LQGGLRFYAL GEAEAAAIAA LQRVFVAGFG ERALARVRPV        60
     GAQQIVYFVG VDTPQAAKAL VNADVYAPRA ALPELETGFY VDLLLGLPVR LGGEVIGEVV       120
     EVIPKATALG QDLLVVDTGE SEHLIPLQAD YVHLHETHVQ LTNPPEGLLE P                171
//

If you have problems or comments...

PBIL Back to PBIL home page