(data stored in ACNUC30630 zone)

EMBL: CP002049.PE73

CP002049.PE73        Location/Qualifiers
FT   CDS             76103..77494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0073"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR019734:IPR013026:IPR001440:IPR013105:IPR
FT                   011990; KEGG: dra:DR_0121 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: C1XZG9 Tetratricopeptide
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13216"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX92"
FT                   /protein_id="ADI13216.1"
FT                   /translation="MGNAKRVRSGVVALALALAPVGWGQEVSAAAQALAAAQRAVAEAR
FT                   ATYQGAPTFDRPLWREAVRQGEAARALEPHNPEVLRFLAETYSTLSWDVRAWDAWEALL
FT                   QAGGELSADDLAQMFAAGRELGYARYTAGELAAAETVFSRMVQLDPENVDALTWLGRIA
FT                   LERGDSVAARAHWARVLELRPNDPTARYYLGRSEQQLAFGAEASGAFHEGLAAYDGGDL
FT                   EGALAAFTRAAEANADFEEAFVWAARTALEAGQPEVAQRYAEALLARDPEHERAGFFMQ
FT                   QIALQRTWGAEAGSAFLEGQGLYSQGRVAEAAERFAAASDANTQFLEAATWAARSYQET
FT                   GQAARAATYWERVVALSPDDARARFFLEEARAQSGVAPAAVSAFNRGLRAYADADLAAA
FT                   EAAFAEATREDPAYAEAWGWLGRLAFEGGRYAEAAAAYAQASALEPADETYAFFAAEAR
FT                   RLAER"
     MGNAKRVRSG VVALALALAP VGWGQEVSAA AQALAAAQRA VAEARATYQG APTFDRPLWR        60
     EAVRQGEAAR ALEPHNPEVL RFLAETYSTL SWDVRAWDAW EALLQAGGEL SADDLAQMFA       120
     AGRELGYARY TAGELAAAET VFSRMVQLDP ENVDALTWLG RIALERGDSV AARAHWARVL       180
     ELRPNDPTAR YYLGRSEQQL AFGAEASGAF HEGLAAYDGG DLEGALAAFT RAAEANADFE       240
     EAFVWAARTA LEAGQPEVAQ RYAEALLARD PEHERAGFFM QQIALQRTWG AEAGSAFLEG       300
     QGLYSQGRVA EAAERFAAAS DANTQFLEAA TWAARSYQET GQAARAATYW ERVVALSPDD       360
     ARARFFLEEA RAQSGVAPAA VSAFNRGLRA YADADLAAAE AAFAEATRED PAYAEAWGWL       420
     GRLAFEGGRY AEAAAAYAQA SALEPADETY AFFAAEARRL AER                         463
//

If you have problems or comments...

PBIL Back to PBIL home page