(data stored in ACNUC30630 zone)

EMBL: CP002049.PE78

CP002049.PE78        Location/Qualifiers
FT   CDS             complement(91876..94434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0078"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209:IPR007280; KEGG: dra:DR_A0283 serine
FT                   protease; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; SPTR: Q9RYM8 Probable
FT                   subtilase-type serine protease DR_A0283; PFAM: Bacterial
FT                   pre-peptidase C-terminal domain; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13221"
FT                   /db_xref="GOA:D7CX97"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX97"
FT                   /protein_id="ADI13221.1"
FT                   /translation="MTRSVIGTLLLALALAACTLNPPAPSVRNPTPSYTIDRVGDQSFI
FT                   RGQLIVGYREGASPEAIARRLGATVQQDWPLLRAALLQLPPRLSVPKAKVSAERLEGVR
FT                   YAEPNLVHFRPEPARGVATTALSPTQVSVSDPEFGRQWMHRQMNSLGAWSQGVSGSGIR
FT                   IGIHDDFIDHRHPDLVDNMFYPGFDGFAASNPEVPIEAALITPETPHDGVGFHGTSVAG
FT                   TAAAVGNDLGGRGTAYGASIVPLAINEPEQGGLVLSAIVNSAIFAVLGPDFAFGGDDRA
FT                   PGTDPETGPYVHIVNMSWGGAFYNQLIKDTMDLMLASGIVLVTSAGNTPTEGPSFPSWN
FT                   PGLINVAATTARGTRTNFSNRGLHLDLAAPGENIWTTTTRGCIFATPDGASCSEEEPEV
FT                   AYTYINGTSFSSPAVAGTAALILEAGAERDAEGNITALPSAAQVQRVLTETAFQPSGYE
FT                   RSALGAGIADSAAAVARVLSGDPIPDGGSLLAEVVWAGNPDIRVPQVGLTLIPEDGDAA
FT                   VKYTQTSDGTLLTPLGIGLFQQMPSGRYTLQASGPYRSVHGIEVGTAQTSVEIRPGEAT
FT                   AVRLALELSPFEDPFEPNNTLETAAELEEVGVTVRASLYDPEAASDVDVYSIPVTAGSV
FT                   YRASLKTASGNVAPALTVYDASGTPIAQSGSTQAFTLNPFVEFEAPEDGLAYIEVTETS
FT                   GLEGSNSPFNLYDLDIARYIGEEEEPNGSAVVIGTSIQNIDFTDAQRIPLGSALDAELT
FT                   EGDTDIFQVEVPAGATVVGDIVTAVDGQPDTLLGVYNEAGQQVAFNDDYNGRASRVLYA
FT                   SQTGGLYYFVVAPWDAINPQNATTGPYNFSVTRHLNPPTE"
     MTRSVIGTLL LALALAACTL NPPAPSVRNP TPSYTIDRVG DQSFIRGQLI VGYREGASPE        60
     AIARRLGATV QQDWPLLRAA LLQLPPRLSV PKAKVSAERL EGVRYAEPNL VHFRPEPARG       120
     VATTALSPTQ VSVSDPEFGR QWMHRQMNSL GAWSQGVSGS GIRIGIHDDF IDHRHPDLVD       180
     NMFYPGFDGF AASNPEVPIE AALITPETPH DGVGFHGTSV AGTAAAVGND LGGRGTAYGA       240
     SIVPLAINEP EQGGLVLSAI VNSAIFAVLG PDFAFGGDDR APGTDPETGP YVHIVNMSWG       300
     GAFYNQLIKD TMDLMLASGI VLVTSAGNTP TEGPSFPSWN PGLINVAATT ARGTRTNFSN       360
     RGLHLDLAAP GENIWTTTTR GCIFATPDGA SCSEEEPEVA YTYINGTSFS SPAVAGTAAL       420
     ILEAGAERDA EGNITALPSA AQVQRVLTET AFQPSGYERS ALGAGIADSA AAVARVLSGD       480
     PIPDGGSLLA EVVWAGNPDI RVPQVGLTLI PEDGDAAVKY TQTSDGTLLT PLGIGLFQQM       540
     PSGRYTLQAS GPYRSVHGIE VGTAQTSVEI RPGEATAVRL ALELSPFEDP FEPNNTLETA       600
     AELEEVGVTV RASLYDPEAA SDVDVYSIPV TAGSVYRASL KTASGNVAPA LTVYDASGTP       660
     IAQSGSTQAF TLNPFVEFEA PEDGLAYIEV TETSGLEGSN SPFNLYDLDI ARYIGEEEEP       720
     NGSAVVIGTS IQNIDFTDAQ RIPLGSALDA ELTEGDTDIF QVEVPAGATV VGDIVTAVDG       780
     QPDTLLGVYN EAGQQVAFND DYNGRASRVL YASQTGGLYY FVVAPWDAIN PQNATTGPYN       840
     FSVTRHLNPP TE                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page