(data stored in ACNUC30630 zone)

EMBL: CP002049.PE8

CP002049.PE8         Location/Qualifiers
FT   CDS             complement(7590..7940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0008"
FT                   /product="ribosomal protein S6"
FT                   /note="COGs: COG0360 Ribosomal protein S6; InterPro
FT                   IPR000529:IPR020814:IPR014717; KEGG: dge:Dgeo_0166 30S
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like; SPTR: C1XS83 SSU ribosomal protein S6P;
FT                   TIGRFAM: ribosomal protein S6; PFAM: Ribosomal protein S6;
FT                   TIGRFAM: ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13151"
FT                   /db_xref="GOA:D7CWR0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR0"
FT                   /protein_id="ADI13151.1"
FT                   /translation="MHNYDLNVILDPNLSEAQLGLEKDAIAAQIERFEGEVLSTDEWGN
FT                   KRLAYPIRKLNEGYYIIYRLRLPETAPRQLATNLRLRDNVMRVLITRDRPEQRTQRSSE
FT                   RDAGQEAPAASA"
     MHNYDLNVIL DPNLSEAQLG LEKDAIAAQI ERFEGEVLST DEWGNKRLAY PIRKLNEGYY        60
     IIYRLRLPET APRQLATNLR LRDNVMRVLI TRDRPEQRTQ RSSERDAGQE APAASA           116
//

If you have problems or comments...

PBIL Back to PBIL home page