(data stored in ACNUC30630 zone)

EMBL: CP002049.PE85

CP002049.PE85        Location/Qualifiers
FT   CDS             101662..101997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011067; KEGG: cyh:Cyan8802_1846
FT                   hypothetical protein; SPTR: C7QV65 Putative uncharacterized
FT                   protein; manually curated; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13228"
FT                   /db_xref="GOA:D7CXA4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA4"
FT                   /protein_id="ADI13228.1"
FT                   /translation="MSSPRFSAGEVVLLTFPFTGVLGAKRRPALVLLDAGDEDILVARI
FT                   TSALARSAFDVKVQNWRGAGLLLPLVVRLHKLATLEKRLVARMLGALGAEDRDAVRGVL
FT                   ATMWTAL"
     MSSPRFSAGE VVLLTFPFTG VLGAKRRPAL VLLDAGDEDI LVARITSALA RSAFDVKVQN        60
     WRGAGLLLPL VVRLHKLATL EKRLVARMLG ALGAEDRDAV RGVLATMWTA L                111
//

If you have problems or comments...

PBIL Back to PBIL home page