(data stored in ACNUC30630 zone)

EMBL: CP002049.PE86

CP002049.PE86        Location/Qualifiers
FT   CDS             101994..103136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0086"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro
FT                   IPR000277:IPR015424:IPR015421:IPR015422; KEGG:
FT                   rca:Rcas_3473 cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; SPTR:
FT                   A7NPM7 Cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13229"
FT                   /db_xref="GOA:D7CXA5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA5"
FT                   /protein_id="ADI13229.1"
FT                   /translation="MNRELRLETLAVHAGAEPDAATGAVTPPIHLSTTFERDPDGSYPK
FT                   GFVYSRTDNPNRRALEAALAALEGGEAAACFASGSAAVASVLRTLRPGDHVLAPDDLYH
FT                   GVRKLLQQVFVPWGLAVSFADLSDTAAAARALRPNTRLIWVETPSNPLLKLTDIGALAA
FT                   LARDVGALLVCDATWTPPPVTRALTLGAHLVVHSTTKYLAGHSDVLGGAVVAARADGTF
FT                   ERLRAVQNLEGAVPSPFDCWLVLRSLRTLPYRMRAHCDNAARVAAFLAGHARVASVHYP
FT                   GLASHPAHALAARQMAYPGGMLSFRVRGGEAAAMAVAARVRLFTRGTSLGGVESLIEHR
FT                   ASIEGPESTTPRDLLRVSVGLEHPDDLIEDLEQAMAEDLT"
     MNRELRLETL AVHAGAEPDA ATGAVTPPIH LSTTFERDPD GSYPKGFVYS RTDNPNRRAL        60
     EAALAALEGG EAAACFASGS AAVASVLRTL RPGDHVLAPD DLYHGVRKLL QQVFVPWGLA       120
     VSFADLSDTA AAARALRPNT RLIWVETPSN PLLKLTDIGA LAALARDVGA LLVCDATWTP       180
     PPVTRALTLG AHLVVHSTTK YLAGHSDVLG GAVVAARADG TFERLRAVQN LEGAVPSPFD       240
     CWLVLRSLRT LPYRMRAHCD NAARVAAFLA GHARVASVHY PGLASHPAHA LAARQMAYPG       300
     GMLSFRVRGG EAAAMAVAAR VRLFTRGTSL GGVESLIEHR ASIEGPESTT PRDLLRVSVG       360
     LEHPDDLIED LEQAMAEDLT                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page