(data stored in ACNUC30630 zone)

EMBL: CP002049.PE90

CP002049.PE90        Location/Qualifiers
FT   CDS             complement(106240..106836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0091"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR009057:IPR012287; KEGG:
FT                   hau:Haur_1751 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: Q0YPN1 Regulatory protein,
FT                   TetR; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13233"
FT                   /db_xref="GOA:D7CXA9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA9"
FT                   /protein_id="ADI13233.1"
FT                   /translation="MTPTPLKTPKRAAGEDLRVTRTRRALGEALVALTLERGFEHLSVR
FT                   DLAERAGVGYATFFRHYASKEALLEAVSEATLRELTELLGPLSATDDPRGAGTRLFRHA
FT                   AANAALYRVLLRTRHHGPLQRALEVAARSFRETFDDRPGSAVPLEVAAHHVVHACVALL
FT                   EWWLERDMPYPPERMGDVFGALIVGPTKAALQAKG"
     MTPTPLKTPK RAAGEDLRVT RTRRALGEAL VALTLERGFE HLSVRDLAER AGVGYATFFR        60
     HYASKEALLE AVSEATLREL TELLGPLSAT DDPRGAGTRL FRHAAANAAL YRVLLRTRHH       120
     GPLQRALEVA ARSFRETFDD RPGSAVPLEV AAHHVVHACV ALLEWWLERD MPYPPERMGD       180
     VFGALIVGPT KAALQAKG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page