(data stored in ACNUC30630 zone)

EMBL: CP002049.PE92

CP002049.PE92        Location/Qualifiers
FT   CDS             108295..108822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_4635 hypothetical protein; SPTR:
FT                   C4CXI2 Predicted membrane protein, COG3918"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13235"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB1"
FT                   /protein_id="ADI13235.1"
FT                   /translation="MPTPRAKAAHARAAYTQAAPVQAALIGVAAGMRAAVAPALVAHHV
FT                   RRSPHAPLGRLGWLGSRRAAGALTLAAAGELVGDKLPATPDRTDLGPLVGRALSGALCG
FT                   AALCRAAGGRGARGALVGAVSALGGAWAFFHLRRALTAAGVPDLAAALAEDGLVLALAE
FT                   AALGAPRSDRVG"
     MPTPRAKAAH ARAAYTQAAP VQAALIGVAA GMRAAVAPAL VAHHVRRSPH APLGRLGWLG        60
     SRRAAGALTL AAAGELVGDK LPATPDRTDL GPLVGRALSG ALCGAALCRA AGGRGARGAL       120
     VGAVSALGGA WAFFHLRRAL TAAGVPDLAA ALAEDGLVLA LAEAALGAPR SDRVG            175
//

If you have problems or comments...

PBIL Back to PBIL home page