(data stored in ACNUC30630 zone)

EMBL: CP002049.PE94

CP002049.PE94        Location/Qualifiers
FT   CDS             110174..110473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0095"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; KEGG: ote:Oter_4579 putative NAD(P)
FT                   transhydrogenase subunit alpha; SPTR: B5JJ24 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13237"
FT                   /db_xref="GOA:D7CXB3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB3"
FT                   /protein_id="ADI13237.1"
FT                   /translation="MNPPPDTHTLLLLLFIFVLALFLGRELITKVPSQLHTPLMSGSNA
FT                   ISGITIVGAILAAGSEGAFSTALGVVALVAATINVVGGYLVTDRMLGMFKKGGR"
     MNPPPDTHTL LLLLFIFVLA LFLGRELITK VPSQLHTPLM SGSNAISGIT IVGAILAAGS        60
     EGAFSTALGV VALVAATINV VGGYLVTDRM LGMFKKGGR                               99
//

If you have problems or comments...

PBIL Back to PBIL home page