(data stored in SCRATCH zone)

EMBL: CP002059.PE100

CP002059.PE100       Location/Qualifiers
FT   CDS             108978..109607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0122"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="KEGG: ana:all0456 precorrin-8X methylmutase; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62768"
FT                   /db_xref="GOA:D7DVG0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG0"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADI62768.1"
FT                   /translation="MSNYIRDPNQIYRNSFAIIRAETNLDALSDDVAKVAVRLIHACGM
FT                   TDILSDLEYSQTAVQSGREALAAGAPILCDCHMVAEGVTRKRLPANNRVICTINDPEVP
FT                   TISKRLSNTRSAAALELWRFHLDGAIIAIGNAPTALFRLLEILDEGVPRPSLILGFPVG
FT                   FVGAAESKAALAANSRNVPFLTLHGRRGGSAIAAAAINALATEEEI"
     MSNYIRDPNQ IYRNSFAIIR AETNLDALSD DVAKVAVRLI HACGMTDILS DLEYSQTAVQ        60
     SGREALAAGA PILCDCHMVA EGVTRKRLPA NNRVICTIND PEVPTISKRL SNTRSAAALE       120
     LWRFHLDGAI IAIGNAPTAL FRLLEILDEG VPRPSLILGF PVGFVGAAES KAALAANSRN       180
     VPFLTLHGRR GGSAIAAAAI NALATEEEI                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page