(data stored in SCRATCH zone)

EMBL: CP002059.PE104

CP002059.PE104       Location/Qualifiers
FT   CDS             complement(117027..117575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0129"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   ava:Ava_0290 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62772"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG4"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI62772.1"
FT                   /translation="MDTISFLNEYKSGQRNFQGVTLHQAKLTKAELTGVNLSEADLSGA
FT                   DLSEANLSKCNLARANLTNADLSQANLHSANLSEVNLIGADLMKANLLDANLSRADLRG
FT                   ANLMWANLLGANLSEAEMSGAVLSGANLRAANLIGSNINESEFNDTELAEAIITELEMT
FT                   GEILHMGLSHQWITWAGSY"
     MDTISFLNEY KSGQRNFQGV TLHQAKLTKA ELTGVNLSEA DLSGADLSEA NLSKCNLARA        60
     NLTNADLSQA NLHSANLSEV NLIGADLMKA NLLDANLSRA DLRGANLMWA NLLGANLSEA       120
     EMSGAVLSGA NLRAANLIGS NINESEFNDT ELAEAIITEL EMTGEILHMG LSHQWITWAG       180
     SY                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page