(data stored in SCRATCH zone)

EMBL: CP002059.PE105

CP002059.PE105       Location/Qualifiers
FT   CDS             117822..118445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62773"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F1872"
FT                   /protein_id="ADI62773.1"
FT                   /translation="MTTDLTSSITPDFHSILSQTAIAYREGSKPPKADVVVNALLQAEK
FT                   YAKQQRLNYPFDSLMGKWRLCFVTGTKKIRKRGGIVLGKGFYVPRFTSVHISFSIITEQ
FT                   VLDRGEIGNQVQLGSILLNLNGPAKYLGNKNLLAFDFTQMQISFSDRVVYNRQIRSGKT
FT                   QTLDFDNQPIAKLPFFAFFLLTEDFIAARGRGGGLAIWIKANPN"
     MTTDLTSSIT PDFHSILSQT AIAYREGSKP PKADVVVNAL LQAEKYAKQQ RLNYPFDSLM        60
     GKWRLCFVTG TKKIRKRGGI VLGKGFYVPR FTSVHISFSI ITEQVLDRGE IGNQVQLGSI       120
     LLNLNGPAKY LGNKNLLAFD FTQMQISFSD RVVYNRQIRS GKTQTLDFDN QPIAKLPFFA       180
     FFLLTEDFIA ARGRGGGLAI WIKANPN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page