(data stored in SCRATCH zone)

EMBL: CP002059.PE110

CP002059.PE110       Location/Qualifiers
FT   CDS             130034..130729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R6196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62778"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R6196"
FT                   /protein_id="ADI62778.1"
FT                   /translation="MNSKFFSTFAAVSTLAGIVVTAGTSSAASISYTASSGDYAITNFN
FT                   QTLSLQQFDTSLGILTSVTLDIVGFINGNAKFESLNAASSLIRANVSAILNLTQGGVTL
FT                   FSLNPSNSKSYQATAFDGVVDFAGTSAITLDIILDEDVATRTLTNNLESFIGSGNVNFL
FT                   VSAIADSSVTGSGNILSQIGTLAKGQLTVTYNYDASTLIKIPEASLHFTGICSNCWVSF
FT                   VVTSKKKPI"
     MNSKFFSTFA AVSTLAGIVV TAGTSSAASI SYTASSGDYA ITNFNQTLSL QQFDTSLGIL        60
     TSVTLDIVGF INGNAKFESL NAASSLIRAN VSAILNLTQG GVTLFSLNPS NSKSYQATAF       120
     DGVVDFAGTS AITLDIILDE DVATRTLTNN LESFIGSGNV NFLVSAIADS SVTGSGNILS       180
     QIGTLAKGQL TVTYNYDAST LIKIPEASLH FTGICSNCWV SFVVTSKKKP I                231
//

If you have problems or comments...

PBIL Back to PBIL home page