(data stored in SCRATCH zone)

EMBL: CP002059.PE113

CP002059.PE113       Location/Qualifiers
FT   CDS             133259..133978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0140"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: ava:Ava_1750 Crp/FNR family transcriptional
FT                   regulator; PFAM: regulatory protein Crp; SMART: regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62781"
FT                   /db_xref="GOA:D7DVF0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF0"
FT                   /inference="protein motif:PFAM:PF00325"
FT                   /protein_id="ADI62781.1"
FT                   /translation="MQSQSSFSEASRPFLTWQRILDWAQEHYRCRTFSKDERIPARPGL
FT                   LYLVQRGAIRMVGTAQVSATASQLTSRRINRTPEEAFLGFVGAGQPFEIVAQSPFTLQS
FT                   YAHVDQTAVLWMYWHDLDNWPHFRREVMDAFRYQHQRKLLWLSALGQRRTIDRLLGFLT
FT                   LLIEEYGEPAMSETDPDVIRGYCLPFPLTHAQIGSAIGSTRVTVTRLMGKLRQRGLILT
FT                   QGDNLICLPAESINRTN"
     MQSQSSFSEA SRPFLTWQRI LDWAQEHYRC RTFSKDERIP ARPGLLYLVQ RGAIRMVGTA        60
     QVSATASQLT SRRINRTPEE AFLGFVGAGQ PFEIVAQSPF TLQSYAHVDQ TAVLWMYWHD       120
     LDNWPHFRRE VMDAFRYQHQ RKLLWLSALG QRRTIDRLLG FLTLLIEEYG EPAMSETDPD       180
     VIRGYCLPFP LTHAQIGSAI GSTRVTVTRL MGKLRQRGLI LTQGDNLICL PAESINRTN        239
//

If you have problems or comments...

PBIL Back to PBIL home page