(data stored in SCRATCH zone)

EMBL: CP002059.PE122

CP002059.PE122       Location/Qualifiers
FT   CDS             147254..147547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62790"
FT                   /db_xref="GOA:D7DVH0"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4923"
FT                   /protein_id="ADI62790.1"
FT                   /translation="MVTVVVLFNIILSLILFYVAWQVCQLTHKLGIIADRLNSYEHATY
FT                   VVLSTAPAKIYTGQQQIYNLRQKNQNLKLQIQQVRQILNLLLLGRKIWQRYL"
     MVTVVVLFNI ILSLILFYVA WQVCQLTHKL GIIADRLNSY EHATYVVLST APAKIYTGQQ        60
     QIYNLRQKNQ NLKLQIQQVR QILNLLLLGR KIWQRYL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page