(data stored in SCRATCH zone)

EMBL: CP002059.PE127

CP002059.PE127       Location/Qualifiers
FT   CDS             complement(150291..150785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0159"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; KEGG:
FT                   ava:Ava_1796 methionine sulfoxide reductase B; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62795"
FT                   /db_xref="GOA:D7DYH2"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH2"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ADI62795.1"
FT                   /translation="MEKRHFLQISAVLVGTAFFLRYINGSSENMADADTKFEVTKPEEE
FT                   WKTILTSEQFQVLRKHGTERAHTSPLDKTYEPGTYVCAGCGQALFTSDTKFDSGTGWPS
FT                   FFKPIEGAIATTVDRSFFMTRTEVHCSRCGGHLGHVFNDGPRPTGFRYCMNGVSLKFTP
FT                   A"
     MEKRHFLQIS AVLVGTAFFL RYINGSSENM ADADTKFEVT KPEEEWKTIL TSEQFQVLRK        60
     HGTERAHTSP LDKTYEPGTY VCAGCGQALF TSDTKFDSGT GWPSFFKPIE GAIATTVDRS       120
     FFMTRTEVHC SRCGGHLGHV FNDGPRPTGF RYCMNGVSLK FTPA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page