(data stored in SCRATCH zone)

EMBL: CP002059.PE145

CP002059.PE145       Location/Qualifiers
FT   CDS             178286..178528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62813"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ0"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2941"
FT                   /protein_id="ADI62813.1"
FT                   /translation="MKNVLKSPEPEELKNYKLQYSSQFKRWKHLKSNRMTFNAVLQTLV
FT                   ADQKGLCAYCEMSIHENNRSVDHFIPRKQSINKRK"
     MKNVLKSPEP EELKNYKLQY SSQFKRWKHL KSNRMTFNAV LQTLVADQKG LCAYCEMSIH        60
     ENNRSVDHFI PRKQSINKRK                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page