(data stored in SCRATCH zone)

EMBL: CP002059.PE15

CP002059.PE15        Location/Qualifiers
FT   CDS             19895..20083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyn:Cyan7425_2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62683"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62683.1"
FT                   /translation="MFLSESGFREHQKINYPKIQGGLRWANPIHINVGIGLQDIVPAMA
FT                   TVVHEVGKKLKIEGKSE"
     MFLSESGFRE HQKINYPKIQ GGLRWANPIH INVGIGLQDI VPAMATVVHE VGKKLKIEGK        60
     SE                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page