(data stored in SCRATCH zone)

EMBL: CP002059.PE160

CP002059.PE160       Location/Qualifiers
FT   CDS             192096..192257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl4262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62828"
FT                   /db_xref="GOA:D7DYK5"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK5"
FT                   /inference="similar to AA sequence:KEGG:asl4262"
FT                   /protein_id="ADI62828.1"
FT                   /translation="MESPYLIILALMAIVLLVGVTGGVVYLTLADWRDRRRREDETREL
FT                   KRSTAKRR"
     MESPYLIILA LMAIVLLVGV TGGVVYLTLA DWRDRRRRED ETRELKRSTA KRR               53
//

If you have problems or comments...

PBIL Back to PBIL home page