(data stored in SCRATCH zone)

EMBL: CP002059.PE177

CP002059.PE177       Location/Qualifiers
FT   CDS             complement(229811..230005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62845"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM2"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4947"
FT                   /protein_id="ADI62845.1"
FT                   /translation="MNYCPCCSDLLLQHIRRSETYWFCRTYWQEMPVVKRHLSSSLSET
FT                   ILGKVPRKPHKHSFLGGFK"
     MNYCPCCSDL LLQHIRRSET YWFCRTYWQE MPVVKRHLSS SLSETILGKV PRKPHKHSFL        60
     GGFK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page