(data stored in SCRATCH zone)

EMBL: CP002059.PE179

CP002059.PE179       Location/Qualifiers
FT   CDS             234247..235605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0233"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: amr:AM1_0362 DNA-damage-inducible protein,
FT                   putative; TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62847"
FT                   /db_xref="GOA:D7DYM4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM4"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADI62847.1"
FT                   /translation="MPDVLLSRYDFLPRFYRLASVSVFSNMMVPLAGLVDIAFLGHLQD
FT                   IRHLAGVILGTILFDYLYRVLKFMRSSTNTLTAYAVGLDEPKAVLLAGLRSGLIALIVS
FT                   LLILLLQYPIQKFGFFLLSGSPDIEASGVDYFYGRIWGAPAVLLNFVLFGWFLGREKNG
FT                   VVLLMSIVGNGSNVLLDYLMIVKWGWESAGAGLATALSQYLALIIGLIGVALSIEWQAL
FT                   PAAVSEIFDWVSLKETFALKSNILIRYVSLISAYSIFTNLSAVMGTNILAENGLLLQIA
FT                   FLSQFAVQGVGMTIQTLTGNFKSKGNGQQMMPLLTVSMLAALAIALVFAFVSIIFPEQV
FT                   FGLLTNHQEVNDSITIYTIWLLPVLAITAIAFILEGYFIGLKEGTSLRNAVLMAFFVGF
FT                   IPLAIAAWYFQNNHLLWATIVSYMTTIMIALALKLPQTLNHQNLEKQKSLANS"
     MPDVLLSRYD FLPRFYRLAS VSVFSNMMVP LAGLVDIAFL GHLQDIRHLA GVILGTILFD        60
     YLYRVLKFMR SSTNTLTAYA VGLDEPKAVL LAGLRSGLIA LIVSLLILLL QYPIQKFGFF       120
     LLSGSPDIEA SGVDYFYGRI WGAPAVLLNF VLFGWFLGRE KNGVVLLMSI VGNGSNVLLD       180
     YLMIVKWGWE SAGAGLATAL SQYLALIIGL IGVALSIEWQ ALPAAVSEIF DWVSLKETFA       240
     LKSNILIRYV SLISAYSIFT NLSAVMGTNI LAENGLLLQI AFLSQFAVQG VGMTIQTLTG       300
     NFKSKGNGQQ MMPLLTVSML AALAIALVFA FVSIIFPEQV FGLLTNHQEV NDSITIYTIW       360
     LLPVLAITAI AFILEGYFIG LKEGTSLRNA VLMAFFVGFI PLAIAAWYFQ NNHLLWATIV       420
     SYMTTIMIAL ALKLPQTLNH QNLEKQKSLA NS                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page