(data stored in SCRATCH zone)

EMBL: CP002059.PE181

CP002059.PE181       Location/Qualifiers
FT   CDS             236420..237628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0235"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: ava:Ava_2027 periplasmic sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62849"
FT                   /db_xref="GOA:D7DYM6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM6"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADI62849.1"
FT                   /translation="MSRPIQINNHPFRFLLYLEWILLVFSVLMVILPSPSPKFAAKFPE
FT                   LTICSLAFFGLMGLRLPTSNQFGKIIYTATEVFLILITGFLGGRTARLFPFLYLMLVTR
FT                   SCLIFQLPGRLTVTFSSFVLFLMTLKTRWMPNRLTPIVQERFRFFSFSLSVLFGLSLVF
FT                   VLLLMNAVLSERQSREKLGIANDKLRQYALKIETQATLEERNRIAREIHDSLGHSLTAL
FT                   NLQLETALKLSKSDIPRAMTFLTRAKELGSKALQDVRNSVSTMRSHPLQSQSLEQAIGI
FT                   LIEDFQRANGILPSCLVSLEYAIPTEMSIPIYRIIQESFTNISKYAQASLVQLELSTTD
FT                   KAVKLIVQDNGRGFDVTQNTTGFGLQSMRDRTLALGGAFTIKSAQNSGCQIIVDIPLAR
FT                   WKT"
     MSRPIQINNH PFRFLLYLEW ILLVFSVLMV ILPSPSPKFA AKFPELTICS LAFFGLMGLR        60
     LPTSNQFGKI IYTATEVFLI LITGFLGGRT ARLFPFLYLM LVTRSCLIFQ LPGRLTVTFS       120
     SFVLFLMTLK TRWMPNRLTP IVQERFRFFS FSLSVLFGLS LVFVLLLMNA VLSERQSREK       180
     LGIANDKLRQ YALKIETQAT LEERNRIARE IHDSLGHSLT ALNLQLETAL KLSKSDIPRA       240
     MTFLTRAKEL GSKALQDVRN SVSTMRSHPL QSQSLEQAIG ILIEDFQRAN GILPSCLVSL       300
     EYAIPTEMSI PIYRIIQESF TNISKYAQAS LVQLELSTTD KAVKLIVQDN GRGFDVTQNT       360
     TGFGLQSMRD RTLALGGAFT IKSAQNSGCQ IIVDIPLARW KT                          402
//

If you have problems or comments...

PBIL Back to PBIL home page