(data stored in SCRATCH zone)

EMBL: CP002059.PE184

CP002059.PE184       Location/Qualifiers
FT   CDS             239829..240035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tlr1991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62852"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62852.1"
FT                   /translation="METMRLIVTVSVGAGKSTFIRSVSEIEVVDTDTRATDETALLKQR
FT                   SNTHRLSRCMVRGRCIPCHWIRE"
     METMRLIVTV SVGAGKSTFI RSVSEIEVVD TDTRATDETA LLKQRSNTHR LSRCMVRGRC        60
     IPCHWIRE                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page