(data stored in SCRATCH zone)

EMBL: CP002059.PE189

CP002059.PE189       Location/Qualifiers
FT   CDS             253640..253837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62857"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62857.1"
FT                   /translation="MFRMTLLNKPFLVSIPSPEEQTQKEEVKQHKSAFHRCFEIYTTCH
FT                   SSSDTRSSDEAEPDLMGGYV"
     MFRMTLLNKP FLVSIPSPEE QTQKEEVKQH KSAFHRCFEI YTTCHSSSDT RSSDEAEPDL        60
     MGGYV                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page