(data stored in SCRATCH zone)

EMBL: CP002059.PE240

CP002059.PE240       Location/Qualifiers
FT   CDS             complement(327356..328672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0325"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="TIGRFAM: FolC bifunctional protein; KEGG:
FT                   ana:alr1026 folylpolyglutamate synthase; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62908"
FT                   /db_xref="GOA:D7DZF6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF6"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ADI62908.1"
FT                   /translation="MNIDSLLQPLQHFGVNLGLTRIVKLLANLDNPHHQVPLIHVGGTN
FT                   GKGSVCAYLSSVLTEAGYRTGRYTSPHLVDWTERICINERPINPETLSQLILRIQSAID
FT                   LREESPTQFEVITAAAWLYFAQQKVDVAIVEVGLGGRLDATNVCPKPLVTVITSISREH
FT                   WQQLGPTVADIAGEKAGIIKPGCPVVIGQLPADAEKVVRARSLELQCPIIAPQPAQEIN
FT                   PGWAEYYKIQNSKYPPGNHPPGLYQIENSESIRYHLPLQGQIQLHNSTLALAALEILQK
FT                   QGWQISEQTIINGIGKTKWPGRMQWFTWKHNNYNYQLLIDGAHNPASAQVLRNYVDSFS
FT                   TQNITWVIGMLATKDHSDIFHALLKTGDKLYLVPVPDNNSANLDHLSKLANETYPDLGF
FT                   CSTYPDVFSALDAAFTSTDNLVVLCGSLYLIGHFLGNSN"
     MNIDSLLQPL QHFGVNLGLT RIVKLLANLD NPHHQVPLIH VGGTNGKGSV CAYLSSVLTE        60
     AGYRTGRYTS PHLVDWTERI CINERPINPE TLSQLILRIQ SAIDLREESP TQFEVITAAA       120
     WLYFAQQKVD VAIVEVGLGG RLDATNVCPK PLVTVITSIS REHWQQLGPT VADIAGEKAG       180
     IIKPGCPVVI GQLPADAEKV VRARSLELQC PIIAPQPAQE INPGWAEYYK IQNSKYPPGN       240
     HPPGLYQIEN SESIRYHLPL QGQIQLHNST LALAALEILQ KQGWQISEQT IINGIGKTKW       300
     PGRMQWFTWK HNNYNYQLLI DGAHNPASAQ VLRNYVDSFS TQNITWVIGM LATKDHSDIF       360
     HALLKTGDKL YLVPVPDNNS ANLDHLSKLA NETYPDLGFC STYPDVFSAL DAAFTSTDNL       420
     VVLCGSLYLI GHFLGNSN                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page